Adrenocorticotropic hormone fragment 7-38

BGC Id:	932288546797
CAS No:	68563-24-6
Synonyms:	corticotropin a ; corticotropin-inhibiting peptide (cip) ; acth(7-38 ; acth (7-38) (human) ; corticotropin-inhibiting peptide (human) ; adrenocorticotropic hormone fragment 7-38 ; cip (human) ; 9: pn:us20090175821 seqid: 9 claimed protein ; acth 1-39 ; corticotropin-inhibiting peptide ; 4: pn: wo0069900 seqid: 9 unclaimed protein ; corticotropin-inhibitingpeptide (human) ; frwgkpvgkkrrpvkvypngaedesaeafple
Molecular Formula:	C167H257 N47 O46
Molecular Weight:	3659.11
EINECS:

Verified providers in 2025

The following notable provider has been checked and can be recommended.

BuGuCh & Partners

Company type: Producer

Country: Germany

We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production site ...

INQUIRY | ORDER

What other providers are available for CAS 68563-24-6?

The last intensive check and update was carried out on 2025/10/30.

Identify

Synonyms:

corticotropin a ; corticotropin-inhibiting peptide (cip) ; acth(7-38 ; acth (7-38) (human) ; corticotropin-inhibiting peptide (human) ; adrenocorticotropic hormone fragment 7-38 ; cip (human) ; 9: pn:us20090175821 seqid: 9 claimed protein ; acth 1-39 ; corticotropin-inhibiting peptide ; 4: pn: wo0069900 seqid: 9 unclaimed protein ; corticotropin-inhibitingpeptide (human) ; frwgkpvgkkrrpvkvypngaedesaeafple

CAS:

68563-24-6

EINECS:

Molecular Formula:

C167H257 N47 O46

MDL:

Properties

Molecular Weight:

3659.11 g·mol−1

Safety Information

Hazard Classes:

Safety Codes:

22-24/25 (S)

WGK Germany:

Storage temperature:

-20°C

What other providers are available for CAS 68563-24-6?

In addition to the providers presented here for Adrenocorticotropic hormone fragment 7-38 with the CAS number 68563-24-6, there are other 17 providers with slightly different product names available for this CAS number.

ACTH (7-38) (human)

Leap Chem Co., Ltd | BuGuCh & Partners +7 additional providers that we know from the past

a7-38-Corticotropin (swine),31-L-serine-

+2 additional providers that we know from the past

ACTH (7-38), human;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

+2 additional providers that we know from the past

ACTH (7-38) (human); Corticotropin-Inhibiting Peptide (CIP)

+2 additional providers that we know from the past

H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH

+2 additional providers that we know from the past