H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

BGC Id:	475052985484
CAS No:	123583-37-9
Synonyms:	3-36 peptide yy (human) ; pyy (3-36) (human) ; l-tyrosinamide,l-isoleucyl-l-lysyl-l-prolyl-l-a-glutamyl-l-alanyl-l-prolylglycyl-l-a-glutamyl-l-a-aspartyl-l-alanyl-l-seryl-l-prolyl-l-a-glutamyl-l-a-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; peptide yy fragment 3-36 ; peptide yy (human, 3-36) ; peptide yy (3-36) (human) ; human peptide yy (3-36) ; peptide yy (3-36) ; pyy (human, 3-36) ; 3-36-human peptide yy ; 12: pn: us20060171920 seqid: 12 claimed protein ; pyy3-36' human ; peptide yy (human) ; peptideyg (lophius americanus pancreatic islet),1-de-l-tyrosine-2-de-l-proline-3-l-isoleucine-7-l-alanine-10-l-glutamicacid-11-l-aspartic acid-16-l-glutamicacid-17-l-leucine-18-l-asparagine-19-l-arginine-21-l-tyrosine-23-l-serine-24-l-leucine-28-l-leucine-31-l-valine-36-l-tyrosinamide-37-deglycine-
Molecular Formula:	C180H279 N53 O54
Molecular Weight:
EINECS:

The most competitive supplier in 2026

The following notable provider has been checked and can be recommended.

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier

Phone: +852-30606658
Country: P.R.China

LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer se ...

INQUIRY | ORDER

What other providers are available for CAS 123583-37-9?

The last intensive check and update was carried out on 2026/03/10.

Identify

Synonyms:

3-36 peptide yy (human) ; pyy (3-36) (human) ; l-tyrosinamide,l-isoleucyl-l-lysyl-l-prolyl-l-a-glutamyl-l-alanyl-l-prolylglycyl-l-a-glutamyl-l-a-aspartyl-l-alanyl-l-seryl-l-prolyl-l-a-glutamyl-l-a-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; peptide yy fragment 3-36 ; peptide yy (human, 3-36) ; peptide yy (3-36) (human) ; human peptide yy (3-36) ; peptide yy (3-36) ; pyy (human, 3-36) ; 3-36-human peptide yy ; 12: pn: us20060171920 seqid: 12 claimed protein ; pyy3-36' human ; peptide yy (human) ; peptideyg (lophius americanus pancreatic islet),1-de-l-tyrosine-2-de-l-proline-3-l-isoleucine-7-l-alanine-10-l-glutamicacid-11-l-aspartic acid-16-l-glutamicacid-17-l-leucine-18-l-asparagine-19-l-arginine-21-l-tyrosine-23-l-serine-24-l-leucine-28-l-leucine-31-l-valine-36-l-tyrosinamide-37-deglycine-

CAS:

123583-37-9

EINECS:

Molecular Formula:

C180H279 N53 O54

MDL:

Safety Information

Hazard Classes:

WGK Germany:

Storage temperature:

-20°C

What other providers are available for CAS 123583-37-9?

In addition to the providers presented here for H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 with the CAS number 123583-37-9, there are other 13 providers with slightly different product names available for this CAS number.

Peptide YY (3-36) (human)

BOC Sciences | Leap Chem Co., Ltd | BuGuCh & Partners +7 additional providers that we know from the past

Peptide YY (3-36) (human) Acetate (GMP)

+1 additional providers that we know from the past

Peptide YY (3-36), human;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

+2 additional providers that we know from the past